PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g034630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 726aa    MW: 79310.2 Da    PI: 7.3362
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g034630.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-095195561954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Sopen02g034630.1 519 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 556
                       664559******************************88 PP

2BELL121.43.9e-39380451172
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       +r e+q++k+kLls+l+eVd+rY++y+eq+q+v++sF+ v+g g+a pYt+lA+ka+SrhFrcLkdai  q+
  Sopen02g034630.1 380 DRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAVPYTALAQKAMSRHFRCLKDAIGAQL 451
                       589*****************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.1E-74318449IPR006563POX domain
PfamPF075263.6E-51323447IPR006563POX domain
PROSITE profilePS5007112.568497560IPR001356Homeobox domain
CDDcd000864.34E-13500561No hitNo description
SMARTSM003892.0E-9500564IPR001356Homeobox domain
SuperFamilySSF466895.13E-17502567IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28503566IPR009057Homeodomain-like
PfamPF059203.6E-18517556IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MGIATQPITL RPCHKYPVIH QVVENLNSMS QDYHHHSLFS FPNGFERSQA EQQQQQQQHQ  60
QAQQIRRDKL RVQGFEPFED ETSGLPTVYE TAGMLSEMFN FPPGNAATNA AELLETQFNP  120
NFRQPNPRIH AAAAMGNEWF GNHRQGMVVG GGASSQPLGY AKNHTDSMQL FLMNPQPRSP  180
SPSPPNSTSS TLHMLLPNPS STPTLQGFPN PAEGSFGQFM TWGNGGASAA TATHHLNAQN  240
EIGGVNVVES QGLSLSLSSS LQHKAEELQM SGEAGGMLFF NQGGSSTSGQ YRYKNMNMGG  300
SGISPNIHQV HVGYGSSLGV VNVLRNSKYA KAAQELLEEF CSVGRGKLKK NNNKAAANNP  360
SGGANNEASS KDVPTLSAAD RIEHQRRKVK LLSMLDEVDR RYNHYCEQMQ MVVNSFDLVM  420
GFGAAVPYTA LAQKAMSRHF RCLKDAIGAQ LKQSCELLGE KDAGTSGLTK GETPRLKMLE  480
QSLRQQRAFH QMGMMEQEAW RPQRGLPERS VNILRAWLFE HFLHPYPSDA DKHLLARQTG  540
LSRNQVSNWF INARVRLWKP MVEDMYQQEA KDEDENSQSQ NSGNNIIAQT PTPNSLTNSS  600
STNITTTTAT TTTAPTTTTA LAAAETGTAA TPITVTSSKR SQINATDSDP SLVAINSFSE  660
NQAAFTTNIH DPDACRRGNF SGDDGTTTHN HMGSTMIRFG TTAGDVSLTL GLRHAGNLPE  720
NTHFFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B2e-16506563562Homeobox protein Meis2
3k2a_A2e-16506563562Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3526540.0EU352654.1 Solanum lycopersicum BIPINNATA (BIP) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015066078.10.0PREDICTED: BEL1-like homeodomain protein 2
SwissprotQ9SW801e-171BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLK4BCE50.0K4BCE5_SOLLC; Uncharacterized protein
STRINGSolyc02g089940.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-151BEL1-like homeodomain 2